PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Pavir.4KG119400.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Panicodae; Paniceae; Panicinae; Panicum
Family FAR1
Protein Properties Length: 83aa    MW: 9987.27 Da    PI: 7.4061
Description FAR1 family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Pavir.4KG119400.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1FAR130.41.3e-093174144
                 FAR1  1 kfYneYAkevGFsvrkskskkskrngeitkrtfvCskegkreee 44
                         +fYn+Y  + GFsvrk+k +++  ++e+++++ vCs eg+r+e+
  Pavir.4KG119400.1.p 31 EFYNAYTFHKGFSVRKDKVRYKPSTKEVKWKRVVCSFEGYRSEK 74
                         6****************************************987 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF031016.3E-73175IPR004330FAR1 DNA binding domain
Sequence ? help Back to Top
Protein Sequence    Length: 83 aa     Download sequence    Send to blast
MEANGYVCLE EIEEYNYVAN QKFNTEEDFF EFYNAYTFHK GFSVRKDKVR YKPSTKEVKW  60
KRVVCSFEGY RSEKHLFLFP LS*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_012700767.13e-26PREDICTED: protein FAR1-RELATED SEQUENCE 5-like
TrEMBLK3YLN51e-25K3YLN5_SETIT; Uncharacterized protein
STRINGSi015159m4e-25(Setaria italica)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP2449976